Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QB Peptide - middle region

C1QB Peptide - middle region

Product Specifications

UniProt

P14106

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033907.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: INSPLRPNQVIRFEKVITNANENYEPRNGKFTCKVPGLYYFTYHASSRGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAT3 (NM_001102386) Human Tagged ORF Clone Lentiviral Particle
RC224201L4V 200 µL

GNAT3 (NM_001102386) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse APP siRNA
abx907873-01 15 nmol

Mouse APP siRNA

Sign In for Pricing
View Details
Mouse APP siRNA
abx907873-02 30 nmol

Mouse APP siRNA

Sign In for Pricing
View Details
Rat Phosphatidylcholine Antibody IgG ELISA KIT
ED0068Ra-01 96 Well

Rat Phosphatidylcholine Antibody IgG ELISA KIT

Sign In for Pricing
View Details
Rabbit Gliadin Antibody (Anti-GA) ELISA Kit
MBS9925007 Inquire

Rabbit Gliadin Antibody (Anti-GA) ELISA Kit

Sign In for Pricing
View Details
CD61 (ITGB3) Human Over-expression Lysate
orb1361978 20 µg

CD61 (ITGB3) Human Over-expression Lysate

Sign In for Pricing
View Details