PIM2 Peptide - middle region
PIM2 Peptide - middle region
Product Specifications
Product Name Alternative
Pim-2, DXCch3
UniProt
Q62070
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_613072.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS072819-01 48 Well
Camel Wingless-Type Mmtv Integration Site Family, Member 4 ELISA Kit
Sign In for Pricing
View Details MBS072819-02 96 Well
Camel Wingless-Type Mmtv Integration Site Family, Member 4 ELISA Kit
Sign In for Pricing
View Details MBS072819-03 5x 96 Well
Camel Wingless-Type Mmtv Integration Site Family, Member 4 ELISA Kit
Sign In for Pricing
View Details MBS072819-04 10x 96 Well
Camel Wingless-Type Mmtv Integration Site Family, Member 4 ELISA Kit
Sign In for Pricing
View Details MBS6180480-01 0.1 mL
ARHGEF1 (Rho Guanine Nucleotide Exchange Factor (GEF) 1, GEF1, LBCL2, LSC, P115-RHOGEF, SUB1.5) (HRP)
Sign In for Pricing
View Details MBS6180480-02 5x 0.1 mL
ARHGEF1 (Rho Guanine Nucleotide Exchange Factor (GEF) 1, GEF1, LBCL2, LSC, P115-RHOGEF, SUB1.5) (HRP)
Sign In for Pricing
View Details