Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIM2 Peptide - middle region

PIM2 Peptide - middle region

Product Specifications

Product Name Alternative

Pim-2, DXCch3

UniProt

Q62070

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_613072.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIC 231-N-A3-B7527 AC Signs
808361 Card of 1 Pictogram(s)

PIC 231-N-A3-B7527 AC Signs

Sign In for Pricing
View Details
Donkey H2A Histone Family, Member V ELISA Kit
MBS083395 Inquire

Donkey H2A Histone Family, Member V ELISA Kit

Sign In for Pricing
View Details
CCDC126 Protein Vector (Human) (pPM-C-His)
PV007820 500 ng

CCDC126 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Anti Human GRIN2C Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200UL
IRBAHUGRIN2CAP00200UL 200 µL

Rabbit Anti Human GRIN2C Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200UL

Sign In for Pricing
View Details
Recombinant Dog Arginine esterase Protein, His-SUMO, E.coli-10ug
QP7377-ec-10ug 10ug

Recombinant Dog Arginine esterase Protein, His-SUMO, E.coli-10ug

Sign In for Pricing
View Details
Human Flt3 Ligand ELISA Kit PicoKine®
EK0354 96 Well With Removable Strips

Human Flt3 Ligand ELISA Kit PicoKine®

Sign In for Pricing
View Details