Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP90B1 Peptide - middle region

HSP90B1 Peptide - middle region

Product Specifications

Product Name Alternative

TA-3, Tra1, gp96, ERp99, GRP94, Targ2, Tra-1, endoplasmin

UniProt

P08113

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035761.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAGL2 (NM_002657) Human Over-expression Lysate
LC419191 20 µg

PLAGL2 (NM_002657) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Prostate
CR560749 5 µg

Tissue Total RNA, Prostate

Sign In for Pricing
View Details
WTAP Antibody
8C11057-AAT 50 µg

WTAP Antibody

Sign In for Pricing
View Details
Glutathione (GSH) Fluorescent Detection Kit
K006-F5 5 Plates

Glutathione (GSH) Fluorescent Detection Kit

Sign In for Pricing
View Details
PPT2 Human qPCR Primer Pair (NM_138717)
HP229758 200 Reactions

PPT2 Human qPCR Primer Pair (NM_138717)

Sign In for Pricing
View Details
Human NOS3/eNOS (Nitric Oxide Synthase 3, Endothelial) ELISA Kit
E-EL-H0755-01 24 Tests

Human NOS3/eNOS (Nitric Oxide Synthase 3, Endothelial) ELISA Kit

Sign In for Pricing
View Details