Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP90B1 Peptide - middle region

HSP90B1 Peptide - middle region

Product Specifications

Product Name Alternative

TA-3, Tra1, gp96, ERp99, GRP94, Targ2, Tra-1, endoplasmin

UniProt

P08113

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035761.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3-Dichlorobenzaldehyde
TRC-D431915-50G 50 g

2,3-Dichlorobenzaldehyde

Sign In for Pricing
View Details
Docosahexaenoic Acid Ethyl Ester
TRC-D494505-50MG 50 mg

Docosahexaenoic Acid Ethyl Ester

Sign In for Pricing
View Details
Endonuclease V (ENDOV) (NM_001164637) Human Over-expression Lysate
LY431196 100 µg

Endonuclease V (ENDOV) (NM_001164637) Human Over-expression Lysate

Sign In for Pricing
View Details
FMPEP-d2
TRC-F193441-10MG 10 mg

FMPEP-d2

Sign In for Pricing
View Details
Bulk Anti-Human CD18 (IB4) Antibody
ICH1189-50mg 50 mg

Bulk Anti-Human CD18 (IB4) Antibody

Sign In for Pricing
View Details
Calb2 Mouse Gene Knockout Kit (CRISPR)
KN502451 1 Kit

Calb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details