Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAT2 Peptide - middle region

ACAT2 Peptide - middle region

Product Specifications

Product Name Alternative

Tcp-1x, AW742799, Tcp1-rs1

UniProt

Q8CAY6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033364.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEAMGKLKPYFLTDGTGTVTPANASGMNDGAAAVVLMKKTEAERRMLKPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS26 (VPS26A) Human qPCR Primer Pair (NM_004896)
HP228271 200 Reactions

VPS26 (VPS26A) Human qPCR Primer Pair (NM_004896)

Sign In for Pricing
View Details
ArylsuLfatase J (ARSJ) (NM_024590) Human Over-expression Lysate
LY403007 100 µg

ArylsuLfatase J (ARSJ) (NM_024590) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant uPA Antibody
RC-16720-01 50 μL

Recombinant uPA Antibody

Sign In for Pricing
View Details
Recombinant uPA Antibody
RC-16720-02 100 µL

Recombinant uPA Antibody

Sign In for Pricing
View Details
Recombinant uPA Antibody
RC-16720-03 1 mL

Recombinant uPA Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD183/CXCR3 Antibody
RD21406F-01 25 µg

PE/Cyanine7 Anti-Mouse CD183/CXCR3 Antibody

Sign In for Pricing
View Details