Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAT2 Peptide - middle region

ACAT2 Peptide - middle region

Product Specifications

Product Name Alternative

Tcp-1x, AW742799, Tcp1-rs1

UniProt

Q8CAY6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033364.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEAMGKLKPYFLTDGTGTVTPANASGMNDGAAAVVLMKKTEAERRMLKPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PLAC8 activation kit by CRISPRa
GA109735 1 Kit

Human PLAC8 activation kit by CRISPRa

Sign In for Pricing
View Details
Caspase 2 (CASP2) (NM_032982) Human Recombinant Protein
TP760618 50 µg

Caspase 2 (CASP2) (NM_032982) Human Recombinant Protein

Sign In for Pricing
View Details
O6-(2-Hydroxyethyl)-2'-deoxyguanosine
TRC-H942020-5MG 5 mg

O6-(2-Hydroxyethyl)-2'-deoxyguanosine

Sign In for Pricing
View Details
Pla2g16 (NM_139269) Mouse Tagged ORF Clone
MG201283 10 µg

Pla2g16 (NM_139269) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human FMS Like Tyrosine Kinase 3 (Flt3) ELISA Kit
RD-Flt3-Hu-01 96 Tests

Human FMS Like Tyrosine Kinase 3 (Flt3) ELISA Kit

Sign In for Pricing
View Details
Human FMS Like Tyrosine Kinase 3 (Flt3) ELISA Kit
RD-Flt3-Hu-02 48 Tests

Human FMS Like Tyrosine Kinase 3 (Flt3) ELISA Kit

Sign In for Pricing
View Details