Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTBP1 Peptide - middle region

PTBP1 Peptide - middle region

Product Specifications

Product Name Alternative

Ptb, PTB2, PTB3, PTB4, pPTB, HNRPI, PTB-1, AA407203, AL033359

UniProt

P17225

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 1 (CASP1) Rabbit Polyclonal Antibody
AP06610PU-N 100 µg

Caspase 1 (CASP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rotary Microtome BHTP-203
BHTP-203 1 Unit

Rotary Microtome BHTP-203

Sign In for Pricing
View Details
Human KIAA1875 (WDR97) activation kit by CRISPRa
GA117477 1 Kit

Human KIAA1875 (WDR97) activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-,  30nm
GP-6401-30 1 mL

Colloidal Gold Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-, 30nm

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS702510 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
FAM102B (NM_001010883) Human Recombinant Protein
TP760946 50 µg

FAM102B (NM_001010883) Human Recombinant Protein

Sign In for Pricing
View Details