Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTBP1 Peptide - middle region

PTBP1 Peptide - middle region

Product Specifications

Product Name Alternative

Ptb, PTB2, PTB3, PTB4, pPTB, HNRPI, PTB-1, AA407203, AL033359

UniProt

P17225

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MICALL2 activation kit by CRISPRa
GA112618 1 Kit

Human MICALL2 activation kit by CRISPRa

Sign In for Pricing
View Details
Aldh6a1 Mouse Gene Knockout Kit (CRISPR)
KN501125 1 Kit

Aldh6a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DREF (ZBED1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E5]
TA505042BM 100 µL

DREF (ZBED1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E5]

Sign In for Pricing
View Details
Anti-TGFβ1
Y058205 100 µL

Anti-TGFβ1

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-E-
LA-1802-1 1 mg

Alkaline Phosphatase Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-E-

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS502942 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details