Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX9 Peptide - middle region

DHX9 Peptide - middle region

Product Specifications

Product Name Alternative

RHA, Ddx9, HEL-5, NDHII, mHEL-5, AI326842

UniProt

O70133

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031868.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGKLAHFEPSQRQNAVGVVPWSPPQSNWNPWTSSNIDEGPLAYASTEQIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syngr4 (NM_021482) Mouse Untagged Clone
MC204934 10 µg

Syngr4 (NM_021482) Mouse Untagged Clone

Sign In for Pricing
View Details
ENO3-set siRNA/shRNA/RNAi Lentivector (Human)
19299091 4x 500 ng

ENO3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Sheep Superoxide dismutase (SOD1) ELISA Kit
MBS7250296-01 48 Well

Sheep Superoxide dismutase (SOD1) ELISA Kit

Sign In for Pricing
View Details
Sheep Superoxide dismutase (SOD1) ELISA Kit
MBS7250296-02 96 Well

Sheep Superoxide dismutase (SOD1) ELISA Kit

Sign In for Pricing
View Details
Sheep Superoxide dismutase (SOD1) ELISA Kit
MBS7250296-03 5x 96 Well

Sheep Superoxide dismutase (SOD1) ELISA Kit

Sign In for Pricing
View Details
Sheep Superoxide dismutase (SOD1) ELISA Kit
MBS7250296-04 10x 96 Well

Sheep Superoxide dismutase (SOD1) ELISA Kit

Sign In for Pricing
View Details