DHX9 Peptide - middle region
DHX9 Peptide - middle region
Product Specifications
Product Name Alternative
RHA, Ddx9, HEL-5, NDHII, mHEL-5, AI326842
UniProt
O70133
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_031868.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IGKLAHFEPSQRQNAVGVVPWSPPQSNWNPWTSSNIDEGPLAYASTEQIS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP70254_P050-Biotin 100 µL
RIPOR1 Antibody - N-terminal region : Biotin (ARP70254_P050-Biotin)
Sign In for Pricing
View Details MBS1125473-01 0.02 mg (E-Coli)
Recombinant Escherichia coli O9:H4 tRNA-specific 2-thiouridylase mnmA (mnmA)
Sign In for Pricing
View Details MBS1125473-02 0.02 mg (Yeast)
Recombinant Escherichia coli O9:H4 tRNA-specific 2-thiouridylase mnmA (mnmA)
Sign In for Pricing
View Details MBS1125473-03 0.1 mg (E-Coli)
Recombinant Escherichia coli O9:H4 tRNA-specific 2-thiouridylase mnmA (mnmA)
Sign In for Pricing
View Details MBS1125473-04 0.1 mg (Yeast)
Recombinant Escherichia coli O9:H4 tRNA-specific 2-thiouridylase mnmA (mnmA)
Sign In for Pricing
View Details MBS1125473-05 0.02 mg (Baculovirus)
Recombinant Escherichia coli O9:H4 tRNA-specific 2-thiouridylase mnmA (mnmA)
Sign In for Pricing
View Details