Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT16 Peptide - middle region

WNT16 Peptide - middle region

Product Specifications

Product Name Alternative

E130309I19Rik

UniProt

Q9QYS1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_444346.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RCHGVSGSCAVKTCWKTMSSFEKIGHFLKDKYENSIQISDKTKRKMRRRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amylin (IAPP) Human Gene Knockout Kit (CRISPR)
KN415074 1 Kit

Amylin (IAPP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Heparan Sulphate Proteoglycan (A7L6), CF594 conjugate, 0.1mg/mL
BNC940315-500 1x 500 µL

Heparan Sulphate Proteoglycan (A7L6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFT81 Human Gene Knockout Kit (CRISPR)
KN401265 1 Kit

IFT81 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LZIC (NM_032368) Human Recombinant Protein
TP309433 20 µg

LZIC (NM_032368) Human Recombinant Protein

Sign In for Pricing
View Details
3,3',3''-(Propane-1,2,3-triyltris(oxy))tris(propan-1-ol)
TRC-P388290-500MG 500 mg

3,3',3''-(Propane-1,2,3-triyltris(oxy))tris(propan-1-ol)

Sign In for Pricing
View Details
Recombinant Human CALR/Calreticulin Protein (Fc Tag)
PKSH030607 50 µg

Recombinant Human CALR/Calreticulin Protein (Fc Tag)

Sign In for Pricing
View Details