Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT16 Peptide - middle region

WNT16 Peptide - middle region

Product Specifications

Product Name Alternative

E130309I19Rik

UniProt

Q9QYS1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_444346.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RCHGVSGSCAVKTCWKTMSSFEKIGHFLKDKYENSIQISDKTKRKMRRRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary: right
CS507915 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS703293 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Recombinant Notch1 Antibody
RC-4568-01 50 μL

Recombinant Notch1 Antibody

Sign In for Pricing
View Details
Recombinant Notch1 Antibody
RC-4568-02 100 µL

Recombinant Notch1 Antibody

Sign In for Pricing
View Details
Recombinant Notch1 Antibody
RC-4568-03 1 mL

Recombinant Notch1 Antibody

Sign In for Pricing
View Details
NAPSIN A (NAPSA) (NM_004851) Human Over-expression Lysate
LC401519 20 µg

NAPSIN A (NAPSA) (NM_004851) Human Over-expression Lysate

Sign In for Pricing
View Details