JDP2 Peptide - middle region
JDP2 Peptide - middle region
Product Specifications
Product Name Alternative
TIF, Jundm2, Jundp2
UniProt
P97875
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001191981.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1444489-01 0.02 mg (E-Coli)
Recombinant Haemophilus somnus Lipoprotein-releasing system ATP-binding protein LolD (lolD)
Sign In for Pricing
View Details MBS1444489-02 0.1 mg (E-Coli)
Recombinant Haemophilus somnus Lipoprotein-releasing system ATP-binding protein LolD (lolD)
Sign In for Pricing
View Details MBS1444489-03 0.02 mg (Yeast)
Recombinant Haemophilus somnus Lipoprotein-releasing system ATP-binding protein LolD (lolD)
Sign In for Pricing
View Details MBS1444489-04 0.1 mg (Yeast)
Recombinant Haemophilus somnus Lipoprotein-releasing system ATP-binding protein LolD (lolD)
Sign In for Pricing
View Details MBS1444489-05 0.02 mg (Baculovirus)
Recombinant Haemophilus somnus Lipoprotein-releasing system ATP-binding protein LolD (lolD)
Sign In for Pricing
View Details