Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JDP2 Peptide - middle region

JDP2 Peptide - middle region

Product Specifications

Product Name Alternative

TIF, Jundm2, Jundp2

UniProt

P97875

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191981.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-AET-N1-cIDPR
BLG-A140-005 0.5 μmoL

8-AET-N1-cIDPR

Sign In for Pricing
View Details
Anti-GJC2 antibody
STJ23796 100 µl

Anti-GJC2 antibody

Sign In for Pricing
View Details
Recombinant Pongo abelii Kinesin-like protein KIF3A (KIF3A), partial
MBS1397761 Inquire

Recombinant Pongo abelii Kinesin-like protein KIF3A (KIF3A), partial

Sign In for Pricing
View Details
Tobramycin Sulfate
290614-01 1 g

Tobramycin Sulfate

Sign In for Pricing
View Details
Tobramycin Sulfate
290614-02 5 g

Tobramycin Sulfate

Sign In for Pricing
View Details
Tobramycin Sulfate
290614-03 10 g

Tobramycin Sulfate

Sign In for Pricing
View Details