Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS25 Peptide - middle region

VPS25 Peptide - middle region

Product Specifications

Product Name Alternative

AW107467, D11Wsu68e, 1110020N13Rik

UniProt

Q9CQ80

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001271340.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGEDTEDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTK Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV716390 1.0 µg DNA

TTK Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Akt2 antibody
MBS5309732-01 0.05 mg

Akt2 antibody

Sign In for Pricing
View Details
Akt2 antibody
MBS5309732-02 5x 0.05 mg

Akt2 antibody

Sign In for Pricing
View Details
1-Aminocyclobutanecarbonitrile >80%
TRC-A617998-500MG 500 mg

1-Aminocyclobutanecarbonitrile >80%

Sign In for Pricing
View Details
Gallein
TRC-G190553-500MG 500 mg

Gallein

Sign In for Pricing
View Details
C19orf30 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV814295 1.0 µg DNA

C19orf30 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details