What is the catalog number for VPS25 Peptide - middle region?

The catalog number for VPS25 Peptide - middle region is orb1997614.

What sizes are available for VPS25 Peptide - middle region?

VPS25 Peptide - middle region is available in the following size(s): 100 µg.

Is VPS25 Peptide - middle region in stock?

VPS25 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

VPS25 Peptide - middle region

Product Specifications

Product Name Alternative

AW107467, D11Wsu68e, 1110020N13Rik

UniProt

Q9CQ80

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001271340.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGEDTEDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

16128064 1.0 µg DNA

CHRNA7 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details

sc-540769 1 Kit

TRAF4 (D-2) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing

View Details

RAPAMAL102 25 Tests

Micro-Albumin Qualitative Rapid Test Cassette [CE]

Sign In for Pricing

View Details

CAU37408-01 100 µL

E1A Binding Protein P300 (EP300) Polyclonal Antibody

Sign In for Pricing

View Details

CAU37408-02 200 µL

E1A Binding Protein P300 (EP300) Polyclonal Antibody

Sign In for Pricing

View Details

CAU37408-03 1 mL

E1A Binding Protein P300 (EP300) Polyclonal Antibody

Sign In for Pricing

View Details