Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSTB Peptide - middle region

CSTB Peptide - middle region

Product Specifications

Product Name Alternative

Stfb, AA960480

UniProt

Q62426

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031819.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGTNLFIKVDVGGDKCVHLRVFQPLPHENKPLTLSSYQTNKERHDELSYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Induction Coil
1090720/4 1 Each

Induction Coil

Sign In for Pricing
View Details
Lentiviral human HCFC1 sgRNA gene knockout kit - Lentiviral human HCFC1 sgRNA gene knockout kit (100)
GTR15400342 1 Vial

Lentiviral human HCFC1 sgRNA gene knockout kit - Lentiviral human HCFC1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Human Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb) ELISA Kit
MBS2706782-01 24 Strip Well

Human Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb) ELISA Kit

Sign In for Pricing
View Details
Human Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb) ELISA Kit
MBS2706782-02 48 Well

Human Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb) ELISA Kit

Sign In for Pricing
View Details
Human Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb) ELISA Kit
MBS2706782-03 96 Well

Human Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb) ELISA Kit

Sign In for Pricing
View Details
Human Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb) ELISA Kit
MBS2706782-04 5x 96 Well

Human Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb) ELISA Kit

Sign In for Pricing
View Details