Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSTB Peptide - middle region

CSTB Peptide - middle region

Product Specifications

Product Name Alternative

Stfb, AA960480

UniProt

Q62426

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031819.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGTNLFIKVDVGGDKCVHLRVFQPLPHENKPLTLSSYQTNKERHDELSYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSANTD4 siRNA (Human)
orb1854788-01 15 nmol

MSANTD4 siRNA (Human)

Sign In for Pricing
View Details
MSANTD4 siRNA (Human)
orb1854788-02 30 nmol

MSANTD4 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Clostridium tetani UPF0348 protein CTC_01238 (CTC_01238)
MBS1374852-01 0.02 mg (E-Coli)

Recombinant Clostridium tetani UPF0348 protein CTC_01238 (CTC_01238)

Sign In for Pricing
View Details
Recombinant Clostridium tetani UPF0348 protein CTC_01238 (CTC_01238)
MBS1374852-02 0.02 mg (Yeast)

Recombinant Clostridium tetani UPF0348 protein CTC_01238 (CTC_01238)

Sign In for Pricing
View Details
Recombinant Clostridium tetani UPF0348 protein CTC_01238 (CTC_01238)
MBS1374852-03 0.1 mg (E-Coli)

Recombinant Clostridium tetani UPF0348 protein CTC_01238 (CTC_01238)

Sign In for Pricing
View Details
Recombinant Clostridium tetani UPF0348 protein CTC_01238 (CTC_01238)
MBS1374852-04 0.1 mg (Yeast)

Recombinant Clostridium tetani UPF0348 protein CTC_01238 (CTC_01238)

Sign In for Pricing
View Details