What is the catalog number for UGT2B17 Peptide - middle region?

The catalog number for UGT2B17 Peptide - middle region is orb1997612.

What sizes are available for UGT2B17 Peptide - middle region?

UGT2B17 Peptide - middle region is available in the following size(s): 100 µg.

Is UGT2B17 Peptide - middle region in stock?

UGT2B17 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

UGT2B17 Peptide - middle region

Product Specifications

Product Name Alternative

M-1, Udpgt-3, Ugt2b17, AI118071, Udpgt2b5

UniProt

P17717

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVLWKFDGKTPATLGHNTRVYKWLPQNDLLGHPKTKAFVTHGGANGVYEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

44137102 1 µg

SLC35C2 AAV Vector (Human) (CMV)

Sign In for Pricing

View Details

E45R33273G-4 50 µL

MT-CO2 Antibody (C-term)

Sign In for Pricing

View Details

orb2563908-01 10 mg

Pseudolaroside A

Sign In for Pricing

View Details

orb2563908-02 50 mg

Pseudolaroside A

Sign In for Pricing

View Details

363062 200 µL

FASN (Fatty Acid Synthase, FAS, OA519, SDR27X1, Short Chain Dehydrogenase/Reductase Family 27X, Member 1, S-acetyltransferase, 3-oxoacyl synthase, Oleoyl hydrolase, Enoyl-acyl-carrier-protein reductase)

Sign In for Pricing

View Details

485807 100 µL

MGST1 (Microsomal Glutathione S-Transferase 1)

Sign In for Pricing

View Details