Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCO1 Peptide - middle region

SCO1 Peptide - middle region

Product Specifications

Product Name Alternative

D11Bwg1310e, 2610001C07Rik

UniProt

Q5SUC9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035115.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IATYVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atholate™, protein hydrolysate, 500 g
0134 500 g

Atholate™, protein hydrolysate, 500 g

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF640R conjugate, 0.1mg/mL
BNC401887-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Macrophage Scavenger Receptor I (MSR1) (NM_138715) Human Over-expression Lysate
LC403366 20 µg

Macrophage Scavenger Receptor I (MSR1) (NM_138715) Human Over-expression Lysate

Sign In for Pricing
View Details
CD74 (LN-2 + CLIP/813), CF640R conjugate, 0.1mg/mL
BNC401207-500 1x 500 µL

CD74 (LN-2 + CLIP/813), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMOD4 Polyclonal Antibody
E-AB-61353-01 60 µL

TMOD4 Polyclonal Antibody

Sign In for Pricing
View Details
TMOD4 Polyclonal Antibody
E-AB-61353-02 120 µL

TMOD4 Polyclonal Antibody

Sign In for Pricing
View Details