Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCO1 Peptide - middle region

SCO1 Peptide - middle region

Product Specifications

Product Name Alternative

D11Bwg1310e, 2610001C07Rik

UniProt

Q5SUC9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035115.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IATYVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polr2g (NM_026329) Mouse Tagged ORF Clone
MG201451 10 µg

Polr2g (NM_026329) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human G-CSF/CSF3 Protein (Fc Tag)
PKSH031938-01 100 µg

Recombinant Human G-CSF/CSF3 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human G-CSF/CSF3 Protein (Fc Tag)
PKSH031938-02 1 mg

Recombinant Human G-CSF/CSF3 Protein (Fc Tag)

Sign In for Pricing
View Details
Human SMIM3 activation kit by CRISPRa
GA113834 1 Kit

Human SMIM3 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human MCM3 protein (His tag)
PDEH100799-01 20 µg

Recombinant Human MCM3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MCM3 protein (His tag)
PDEH100799-02 100 µg

Recombinant Human MCM3 protein (His tag)

Sign In for Pricing
View Details