Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLKL Peptide - middle region

MLKL Peptide - middle region

Product Specifications

Product Name Alternative

9130019I15Rik

UniProt

Q9D2Y4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001297542.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MMP13 Recombinant Rabbit monoclonal Antibody
HA723293 100 µL

Human MMP13 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Thallium Sulfate
TRC-T790543-5G 5 g

Thallium Sulfate

Sign In for Pricing
View Details
HCN2 (NM_001194) Human Over-expression Lysate
LY420072 100 µg

HCN2 (NM_001194) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Cathepsin A/CTSA Protein (His Tag)
PKSH032178-01 10 µg

Recombinant Human Cathepsin A/CTSA Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Cathepsin A/CTSA Protein (His Tag)
PKSH032178-02 50 µg

Recombinant Human Cathepsin A/CTSA Protein (His Tag)

Sign In for Pricing
View Details
YY1 Human Gene Knockout Kit (CRISPR)
KN207198LP 1 Kit

YY1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details