Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLKL Peptide - middle region

MLKL Peptide - middle region

Product Specifications

Product Name Alternative

9130019I15Rik

UniProt

Q9D2Y4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001297542.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLCB1 Antibody
KC-3860-01 50 μL

PLCB1 Antibody

Sign In for Pricing
View Details
PLCB1 Antibody
KC-3860-02 100 µL

PLCB1 Antibody

Sign In for Pricing
View Details
PLCB1 Antibody
KC-3860-03 1 mL

PLCB1 Antibody

Sign In for Pricing
View Details
DFNA5 / GSDME Recombinant Rabbit monoclonal Antibody
HA723113 100 µL

DFNA5 / GSDME Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Biotin Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992B-01 25 µg

Biotin Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details
Biotin Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992B-02 100 µg

Biotin Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details