Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARPC2 Peptide - middle region

ARPC2 Peptide - middle region

Product Specifications

Product Name Alternative

34kDa, p34-Arc, 2210023N03Rik

UniProt

Q9CVB6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_083987.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (CD68/G2), CF568 conjugate, 0.1mg/mL
BNC680919-500 1x 500 µL

CD68 (CD68/G2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5’-Acetyl-2’,3’-isopropylidene Adenosine
TRC-A179575-5G 5 g

5’-Acetyl-2’,3’-isopropylidene Adenosine

Sign In for Pricing
View Details
SYT2 (NM_001136504) Human Over-expression Lysate
LC427901 20 µg

SYT2 (NM_001136504) Human Over-expression Lysate

Sign In for Pricing
View Details
Ensconsin (MAP7) (NM_001198617) Human Over-expression Lysate
LC434356 20 µg

Ensconsin (MAP7) (NM_001198617) Human Over-expression Lysate

Sign In for Pricing
View Details
Human KRTAP2-4 activation kit by CRISPRa
GA113843 1 Kit

Human KRTAP2-4 activation kit by CRISPRa

Sign In for Pricing
View Details
LDB2 (NM_001130834) Human Over-expression Lysate
LY427279 100 µg

LDB2 (NM_001130834) Human Over-expression Lysate

Sign In for Pricing
View Details