Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARPC2 Peptide - middle region

ARPC2 Peptide - middle region

Product Specifications

Product Name Alternative

34kDa, p34-Arc, 2210023N03Rik

UniProt

Q9CVB6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_083987.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BET1L activation kit by CRISPRa
GA109694 1 Kit

Human BET1L activation kit by CRISPRa

Sign In for Pricing
View Details
Exosome Component 9 (EXOSC9) Rabbit Polyclonal Antibody
TA361695 100 µL

Exosome Component 9 (EXOSC9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zap70 Mouse Gene Knockout Kit (CRISPR)
KN519581 1 Kit

Zap70 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human CDC42/G25K Protein (GST Tag)
PKSH031903 100 µg

Recombinant Human CDC42/G25K Protein (GST Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS711391 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human Lambda Light Chain (ICO-106), CF594 conjugate, 0.1mg/mL
BNC940019-100 1x 100 µL

Human Lambda Light Chain (ICO-106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details