Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPK1 Peptide - middle region

TPK1 Peptide - middle region

Product Specifications

UniProt

Q9R0M5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001298040.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASVNTLFQATHITPVPIIIIQKDSLIYLLQPGKHRLHVDTGMEGSWCGLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDPD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
21431066 1.0 µg DNA

GDPD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Phospho-FOXO4 (Thr451) Polyclonal Antibody, Cy5.5 Conjugated
bs-13208R-Cy5.5 100 µL

Phospho-FOXO4 (Thr451) Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
5-Methoxy-L-tryptophan
M-265-500-1g 1 g

5-Methoxy-L-tryptophan

Sign In for Pricing
View Details
Rpl6 Rabbit Polyclonal Antibody
TA363218 100 µL

Rpl6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lenvatinib Impurity 101
RM-L142301-01 10 mg

Lenvatinib Impurity 101

Sign In for Pricing
View Details
Lenvatinib Impurity 101
RM-L142301-02 25 mg

Lenvatinib Impurity 101

Sign In for Pricing
View Details