TPK1 Peptide - middle region
TPK1 Peptide - middle region
Product Specifications
UniProt
Q9R0M5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001298040.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ASVNTLFQATHITPVPIIIIQKDSLIYLLQPGKHRLHVDTGMEGSWCGLI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9934354 Inquire
Goat ER Lumen Protein Retaining Receptor 2 (KDELR2) ELISA Kit
Sign In for Pricing
View Details 220036 10 µg
MEC, Recombinant, Human (Mucosae-associated Epithelial Chemokine, CCL28, CCK-1) discontinued
Sign In for Pricing
View Details MBS5400938-01 5 Applications
Rabbit Anti-Goat Light Chain Positive Control
Sign In for Pricing
View Details