TPK1 Peptide - middle region
TPK1 Peptide - middle region
Product Specifications
UniProt
Q9R0M5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001298040.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ASVNTLFQATHITPVPIIIIQKDSLIYLLQPGKHRLHVDTGMEGSWCGLI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9370251 Inquire
Plant Phosphodiesterase 8B Antibody (Anti-PDE8B) ELISA Kit
Sign In for Pricing
View Details 
MBS2001775-01 0.1 mL
Polyclonal Antibody to Lysyl Oxidase Like Protein 2 (LOXL2)
Sign In for Pricing
View Details MBS2001775-02 0.2 mL
Polyclonal Antibody to Lysyl Oxidase Like Protein 2 (LOXL2)
Sign In for Pricing
View Details MBS2001775-03 0.5 mL
Polyclonal Antibody to Lysyl Oxidase Like Protein 2 (LOXL2)
Sign In for Pricing
View Details MBS2001775-04 1 mL
Polyclonal Antibody to Lysyl Oxidase Like Protein 2 (LOXL2)
Sign In for Pricing
View Details MBS2001775-05 5 mL
Polyclonal Antibody to Lysyl Oxidase Like Protein 2 (LOXL2)
Sign In for Pricing
View Details