What is the catalog number for TPK1 Peptide - middle region?

The catalog number for TPK1 Peptide - middle region is orb1997605.

What sizes are available for TPK1 Peptide - middle region?

TPK1 Peptide - middle region is available in the following size(s): 100 µg.

Is TPK1 Peptide - middle region in stock?

TPK1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

TPK1 Peptide - middle region

Product Specifications

UniProt

Q9R0M5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001298040.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASVNTLFQATHITPVPIIIIQKDSLIYLLQPGKHRLHVDTGMEGSWCGLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-54626APC 0.1 mL

Mouse Monoclonal CEACAM6/CD66c Antibody (1H7-4B) [Allophycocyanin]

Sign In for Pricing

View Details

19615016 1.0 µg DNA

F2rl2 ORF Vector (Rat) (pORF)

Sign In for Pricing

View Details

E2514925 100 µL

FNDC4 Rabbit pAb

Sign In for Pricing

View Details

WHA10087-01 50 mg

2- (4,5,6,7-Tetrahydro-1H-indazol-3-yl) acetic acid

Sign In for Pricing

View Details

WHA10087-02 0.5 g

2- (4,5,6,7-Tetrahydro-1H-indazol-3-yl) acetic acid

Sign In for Pricing

View Details

E2R380741 100 µL

HIF2 alpha Rabbit mAb

Sign In for Pricing

View Details