Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFS3 Peptide - C-terminal region

NDUFS3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CI-30kD, 0610010M09Rik

UniProt

Q9DCT2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_080964.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPESLKLEAGDKKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHI3L1 Antibody
MBS9607233-01 0.1 mL

CHI3L1 Antibody

Sign In for Pricing
View Details
CHI3L1 Antibody
MBS9607233-02 0.2 mL

CHI3L1 Antibody

Sign In for Pricing
View Details
CHI3L1 Antibody
MBS9607233-03 5x 0.2 mL

CHI3L1 Antibody

Sign In for Pricing
View Details
DSTN siRNA (Mouse)
MBS8239950-01 15 nmol

DSTN siRNA (Mouse)

Sign In for Pricing
View Details
DSTN siRNA (Mouse)
MBS8239950-02 30 nmol

DSTN siRNA (Mouse)

Sign In for Pricing
View Details
DSTN siRNA (Mouse)
MBS8239950-03 5x 30 nmol

DSTN siRNA (Mouse)

Sign In for Pricing
View Details