Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P4HB Peptide - C-terminal region

P4HB Peptide - C-terminal region

Product Specifications

Product Name Alternative

PDI, Thbp, ERp59, Pdia1

UniProt

P09103

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035162.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGERTLDGFKKFLESGGQDGAGDDEDLDLEEALEPDMEEDDDQKAVKDEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXCL16 Antibody Pair Set
E-KAB-0541 50 µL & 100 µg

Human CXCL16 Antibody Pair Set

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS641025 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
UNC5B Rabbit Polyclonal Antibody
TA367835 100 µL

UNC5B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sakuranetin
TRC-S084255-1MG 1 mg

Sakuranetin

Sign In for Pricing
View Details
Tungstic Acid
TRC-T897270-50G 50 g

Tungstic Acid

Sign In for Pricing
View Details
Rpl39 (NM_026055) Mouse Tagged ORF Clone
MG200015 10 µg

Rpl39 (NM_026055) Mouse Tagged ORF Clone

Sign In for Pricing
View Details