Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOXO1 Peptide - N-terminal region

NOXO1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hslt, Snx28, P41NOX, P41NOXA, P41NOXB, P41NOXC, 2310034C04Rik

UniProt

Q8VCM2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_082264.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQMDRLQTFAFSVCWSDNSDTFVRRSWDEFRQLQKTLKKTFPVEAGLLRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSM1 Antibody
KC-30265-01 50 μL

LSM1 Antibody

Sign In for Pricing
View Details
LSM1 Antibody
KC-30265-02 100 µL

LSM1 Antibody

Sign In for Pricing
View Details
LSM1 Antibody
KC-30265-03 1 mL

LSM1 Antibody

Sign In for Pricing
View Details
Leuco Gentian Violet-d6 (Major)
TRC-L330203-5MG 5 mg

Leuco Gentian Violet-d6 (Major)

Sign In for Pricing
View Details
Recombinant Mouse CDCP1/CD318 Protein (Fc Tag)
PKSM040351 100 µg

Recombinant Mouse CDCP1/CD318 Protein (Fc Tag)

Sign In for Pricing
View Details
Dichloramine B
TRC-D435963-500MG 500 mg

Dichloramine B

Sign In for Pricing
View Details