Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOXO1 Peptide - N-terminal region

NOXO1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hslt, Snx28, P41NOX, P41NOXA, P41NOXB, P41NOXC, 2310034C04Rik

UniProt

Q8VCM2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_082264.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQMDRLQTFAFSVCWSDNSDTFVRRSWDEFRQLQKTLKKTFPVEAGLLRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 2-Acetamido-4-(4-octylphenyl)butanoate
TRC-E938043-25MG 25 mg

Ethyl 2-Acetamido-4-(4-octylphenyl)butanoate

Sign In for Pricing
View Details
c-Myb (MYB) Human Gene Knockout Kit (CRISPR)
KN209061RB 1 Kit

c-Myb (MYB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS629526 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Mouse Dstn activation kit by CRISPRa
GA205966 1 Kit

Mouse Dstn activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS710516 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human ZNF358 activation kit by CRISPRa
GA115369 1 Kit

Human ZNF358 activation kit by CRISPRa

Sign In for Pricing
View Details