AKR1B1 Peptide - middle region
AKR1B1 Peptide - middle region
Product Specifications
Product Name Alternative
AR, ALR2, Ahr1, Ahr-1, Aldr1, Akr1b1, Aldor1
UniProt
P45376
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_033788.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1313058-01 0.02 mg (E-Coli)
Recombinant Human Leucine-rich repeat-containing protein 1 (LRRC1)
Sign In for Pricing
View Details MBS1313058-02 0.02 mg (Yeast)
Recombinant Human Leucine-rich repeat-containing protein 1 (LRRC1)
Sign In for Pricing
View Details MBS1313058-03 0.1 mg (E-Coli)
Recombinant Human Leucine-rich repeat-containing protein 1 (LRRC1)
Sign In for Pricing
View Details MBS1313058-04 0.1 mg (Yeast)
Recombinant Human Leucine-rich repeat-containing protein 1 (LRRC1)
Sign In for Pricing
View Details MBS1313058-05 0.02 mg (Baculovirus)
Recombinant Human Leucine-rich repeat-containing protein 1 (LRRC1)
Sign In for Pricing
View Details MBS1313058-06 0.02 mg (Mammalian-Cell)
Recombinant Human Leucine-rich repeat-containing protein 1 (LRRC1)
Sign In for Pricing
View Details