What is the catalog number for AKR1B1 Peptide - middle region?

The catalog number for AKR1B1 Peptide - middle region is orb1997601.

What sizes are available for AKR1B1 Peptide - middle region?

AKR1B1 Peptide - middle region is available in the following size(s): 100 µg.

Is AKR1B1 Peptide - middle region in stock?

AKR1B1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

AKR1B1 Peptide - middle region

Product Specifications

Product Name Alternative

AR, ALR2, Ahr1, Ahr-1, Aldr1, Akr1b1, Aldor1

UniProt

P45376

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033788.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

bs-0486R-BF680-TR 20 µL

Integrin beta 1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing

View Details

32-1058-10 10 µg

APOM Recombinant Protein

Sign In for Pricing

View Details

GTR15294041 1 Vial

Lentiviral mouse Psmb8 shRNA (UAS) - Lentiviral mouse Psmb8 shRNA (UAS, iRFP) (25)

Sign In for Pricing

View Details

orb3081327 100 µg

TRIF/TICAM1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing

View Details

CF806735 100 µg

INDOL1 (IDO2) Mouse Monoclonal Antibody [Clone ID: OTI2E10]

Sign In for Pricing

View Details

PAV8302 100 μL

Rabbit Anti-IPIL2/ITPRIPL2 Polyclonal Antibody

Sign In for Pricing

View Details