Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACADL Peptide - C-terminal region

ACADL Peptide - C-terminal region

Product Specifications

Product Name Alternative

LCAD, C79855, AA960361, AU018452

UniProt

P51174

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031407.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVAYECVQLHGGWGYMWEYPIAKAYVDARVQPIYGGTNEIMKELIARQIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

b-Cyanobenzenepropanoic Acid Ethyl Ester
TRC-C962355-1G 1 g

b-Cyanobenzenepropanoic Acid Ethyl Ester

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/1762), Biotin conjugate, 0.1mg/mL
BNCB1762-100 1x 100 µL

Bcl-X (Apoptosis Marker) (BCL2L1/1762), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UBE4A Rabbit Polyclonal Antibody
TA361635 100 µL

UBE4A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LHX2 Mouse Monoclonal Antibody [Clone ID: OTI3E4]
CF810329 100 µg

LHX2 Mouse Monoclonal Antibody [Clone ID: OTI3E4]

Sign In for Pricing
View Details
NME1 Antibody
KC-6208-01 50 μL

NME1 Antibody

Sign In for Pricing
View Details
NME1 Antibody
KC-6208-02 100 µL

NME1 Antibody

Sign In for Pricing
View Details