Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACADL Peptide - C-terminal region

ACADL Peptide - C-terminal region

Product Specifications

Product Name Alternative

LCAD, C79855, AA960361, AU018452

UniProt

P51174

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031407.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVAYECVQLHGGWGYMWEYPIAKAYVDARVQPIYGGTNEIMKELIARQIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catenin, beta (CTNNB1) (rCTNNB1/2173), CF488A conjugate, 0.1mg/mL
BNC882173-500 1x 500 µL

Catenin, beta (CTNNB1) (rCTNNB1/2173), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRPF18 Antibody
8C17852-AAT 50 µg

PRPF18 Antibody

Sign In for Pricing
View Details
ACSL1 (NM_001995) Human Over-expression Lysate
LC419599 20 µg

ACSL1 (NM_001995) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Carbamoyl-3-cyano-4-hydroxy-2,5,6-trichlorobenzene, 2,3,6-Trichloro-5-cyano-4-hydroxybenzamide 13C2-15N2
TRC-C718249-25MG 25 mg

1-Carbamoyl-3-cyano-4-hydroxy-2,5,6-trichlorobenzene, 2,3,6-Trichloro-5-cyano-4-hydroxybenzamide 13C2-15N2

Sign In for Pricing
View Details
Spermidine
TRC-S680400-25G 25 g

Spermidine

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon
CP565846 150 µg

Tissue Protein Lysate, Colon

Sign In for Pricing
View Details