Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGLL Peptide - middle region

MGLL Peptide - middle region

Product Specifications

Product Name Alternative

Mgl, Magl, AA589436

UniProt

O35678

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159721.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Laminin alpha 1(LAMA1) ELISA Kit
MBS2610548-01 48 Well

Bovine Laminin alpha 1(LAMA1) ELISA Kit

Sign In for Pricing
View Details
Bovine Laminin alpha 1(LAMA1) ELISA Kit
MBS2610548-02 96 Well

Bovine Laminin alpha 1(LAMA1) ELISA Kit

Sign In for Pricing
View Details
Bovine Laminin alpha 1(LAMA1) ELISA Kit
MBS2610548-03 5x 96 Well

Bovine Laminin alpha 1(LAMA1) ELISA Kit

Sign In for Pricing
View Details
Bovine Laminin alpha 1(LAMA1) ELISA Kit
MBS2610548-04 10x 96 Well

Bovine Laminin alpha 1(LAMA1) ELISA Kit

Sign In for Pricing
View Details
Loxl1 (NM_001012125) Rat Tagged ORF Clone
RR214661 10 µg

Loxl1 (NM_001012125) Rat Tagged ORF Clone

Sign In for Pricing
View Details
MCCC2 Antibody
OAGA01973-100UL 100 µL

MCCC2 Antibody

Sign In for Pricing
View Details