Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACP5 Peptide - middle region

ACP5 Peptide - middle region

Product Specifications

Product Name Alternative

TRAP, TRACP

UniProt

Q05117

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001095874.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSVRHQRKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Involucrin (Squamous Cell Terminal Differentiation Marker) (rIVRN/827), CF647 conjugate, 0.1mg/mL
BNC473640-100 1x 100 µL

Involucrin (Squamous Cell Terminal Differentiation Marker) (rIVRN/827), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STK23 (SRPK3) Mouse Monoclonal Antibody [Clone ID: OTI6F5]
CF809462 100 µg

STK23 (SRPK3) Mouse Monoclonal Antibody [Clone ID: OTI6F5]

Sign In for Pricing
View Details
Human LRRC17 activation kit by CRISPRa
GA106962 1 Kit

Human LRRC17 activation kit by CRISPRa

Sign In for Pricing
View Details
FITC Conjugated Rabbit Anti-GS-I Antibody
FAL-2401-2 2 mL

FITC Conjugated Rabbit Anti-GS-I Antibody

Sign In for Pricing
View Details
PAFAH1B2 (NM_002572) Human Over-expression Lysate
LC419243 20 µg

PAFAH1B2 (NM_002572) Human Over-expression Lysate

Sign In for Pricing
View Details
(S)-Chlorpheniramine Maleate Salt
TRC-C424305-1G 1 g

(S)-Chlorpheniramine Maleate Salt

Sign In for Pricing
View Details