Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACP5 Peptide - middle region

ACP5 Peptide - middle region

Product Specifications

Product Name Alternative

TRAP, TRACP

UniProt

Q05117

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001095874.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSVRHQRKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRPX (NM_001170752) Human Over-expression Lysate
LY432966 100 µg

SRPX (NM_001170752) Human Over-expression Lysate

Sign In for Pricing
View Details
Lipin 2 (LPIN2) (NM_014646) Human Over-expression Lysate
LC402358 20 µg

Lipin 2 (LPIN2) (NM_014646) Human Over-expression Lysate

Sign In for Pricing
View Details
HLA Class II DQ Mouse Monoclonal Antibody [Clone ID: FN81]
AM05947PU-N 100 µg

HLA Class II DQ Mouse Monoclonal Antibody [Clone ID: FN81]

Sign In for Pricing
View Details
Ɑ-Biotinamido-ω-Squaric Acid Ester Amido PEG
135000-25-50.1G 1 g

Ɑ-Biotinamido-ω-Squaric Acid Ester Amido PEG

Sign In for Pricing
View Details
Frozen Tissue Sections, Tendon
CS638712 5x 5 µm

Frozen Tissue Sections, Tendon

Sign In for Pricing
View Details
1-Nitroso-1-(2-Hydroxyethyl)-3-(2-chloroethyl)urea
TRC-N527963-5MG 5 mg

1-Nitroso-1-(2-Hydroxyethyl)-3-(2-chloroethyl)urea

Sign In for Pricing
View Details