What is the catalog number for HOXC6 Peptide - middle region?

The catalog number for HOXC6 Peptide - middle region is orb1997595.

What sizes are available for HOXC6 Peptide - middle region?

HOXC6 Peptide - middle region is available in the following size(s): 100 µg.

Is HOXC6 Peptide - middle region in stock?

HOXC6 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

HOXC6 Peptide - middle region

Product Specifications

Product Name Alternative

Hox-3.3, Hox-6.1

UniProt

P10629

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034595.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQEKDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb73067 500 µg

Occludin Antibody Blocking Peptide

Sign In for Pricing

View Details

NBP2-74131AF350 0.1 mL

Mouse Monoclonal SerpinB2 Antibody (OTI1G3) [Alexa Fluor 350]

Sign In for Pricing

View Details

K3668608 1.0 µg DNA

2310043J07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing

View Details

MBS8412466-01 0.02 mg

Human GPC3 Protein Lysate

Sign In for Pricing

View Details

MBS8412466-02 5x 0.02 mg

Human GPC3 Protein Lysate

Sign In for Pricing

View Details

SL0120Hu-01 48 Tests

Human Angiotensin Converting Enzyme (ACE) ELISA Kit

Sign In for Pricing

View Details