Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC6 Peptide - middle region

HOXC6 Peptide - middle region

Product Specifications

Product Name Alternative

Hox-3.3, Hox-6.1

UniProt

P10629

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034595.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQEKDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSDMC Antibody
OACA06326-100UG 100 µg

GSDMC Antibody

Sign In for Pricing
View Details
rno-miR-9b-5p miRNA Mimic
MBS8303144-01 5 nmol

rno-miR-9b-5p miRNA Mimic

Sign In for Pricing
View Details
rno-miR-9b-5p miRNA Mimic
MBS8303144-02 10 nmol

rno-miR-9b-5p miRNA Mimic

Sign In for Pricing
View Details
rno-miR-9b-5p miRNA Mimic
MBS8303144-03 5x 10 nmol

rno-miR-9b-5p miRNA Mimic

Sign In for Pricing
View Details
Mouse Ahr (NM_013464) AAV Particle
MR227590A1V 250 µL

Mouse Ahr (NM_013464) AAV Particle

Sign In for Pricing
View Details
Recombinant Human TIMP2/TIMP-2 Protein (Fc Tag)
PKSH030472 20 µg

Recombinant Human TIMP2/TIMP-2 Protein (Fc Tag)

Sign In for Pricing
View Details