Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RARG Peptide - middle region

RARG Peptide - middle region

Product Specifications

Product Name Alternative

RARD, Nr1b3, RAR-gamma, RARgamma2

UniProt

P18911

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001036192.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Brain Protein 44 Like Protein ELISA Kit
MBS081491-01 48 Well

Porcine Brain Protein 44 Like Protein ELISA Kit

Sign In for Pricing
View Details
Porcine Brain Protein 44 Like Protein ELISA Kit
MBS081491-02 96 Well

Porcine Brain Protein 44 Like Protein ELISA Kit

Sign In for Pricing
View Details
Porcine Brain Protein 44 Like Protein ELISA Kit
MBS081491-03 5x 96 Well

Porcine Brain Protein 44 Like Protein ELISA Kit

Sign In for Pricing
View Details
Porcine Brain Protein 44 Like Protein ELISA Kit
MBS081491-04 10x 96 Well

Porcine Brain Protein 44 Like Protein ELISA Kit

Sign In for Pricing
View Details
CPA4 siRNA (Mouse)
MBS8204526-01 15 nmol

CPA4 siRNA (Mouse)

Sign In for Pricing
View Details
CPA4 siRNA (Mouse)
MBS8204526-02 30 nmol

CPA4 siRNA (Mouse)

Sign In for Pricing
View Details