Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RARG Peptide - middle region

RARG Peptide - middle region

Product Specifications

Product Name Alternative

RARD, Nr1b3, RAR-gamma, RARgamma2

UniProt

P18911

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001036192.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM79 activation kit by CRISPRa
GA113480 1 Kit

Human TMEM79 activation kit by CRISPRa

Sign In for Pricing
View Details
Phosphotyrosine (P-Tyr) (PY265), Biotin conjugate, 0.1mg/mL
BNCB0265-500 1x 500 µL

Phosphotyrosine (P-Tyr) (PY265), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NDUFB10 Human Gene Knockout Kit (CRISPR)
KN400526 1 Kit

NDUFB10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ASB8 Mouse Monoclonal Antibody [Clone ID: OTI1A6]
CF808405 100 µg

ASB8 Mouse Monoclonal Antibody [Clone ID: OTI1A6]

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/3132R), CF647 conjugate, 0.1mg/mL
BNC473132-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/3132R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCO2 (NM_001037290) Human Over-expression Lysate
LY421941 100 µg

BCO2 (NM_001037290) Human Over-expression Lysate

Sign In for Pricing
View Details