Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKBIZ Peptide - C-terminal region

NFKBIZ Peptide - C-terminal region

Product Specifications

Product Name Alternative

INAP, Mail, AA408868

UniProt

Q9EST8

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001152866.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR12 (Center) Rabbit Polyclonal Antibody
AP54534PU-N 400 µL

WDR12 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Aminoacylase 1 (ACY1) (NM_001198897) Human Over-expression Lysate
LY434175 100 µg

Aminoacylase 1 (ACY1) (NM_001198897) Human Over-expression Lysate

Sign In for Pricing
View Details
Human αMSH (Alpha-Melanocyte Stimulating Hormone) ELISA Kit
E-EL-H2414-01 24 Tests

Human αMSH (Alpha-Melanocyte Stimulating Hormone) ELISA Kit

Sign In for Pricing
View Details
Human αMSH (Alpha-Melanocyte Stimulating Hormone) ELISA Kit
E-EL-H2414-02 48 Tests

Human αMSH (Alpha-Melanocyte Stimulating Hormone) ELISA Kit

Sign In for Pricing
View Details
Human αMSH (Alpha-Melanocyte Stimulating Hormone) ELISA Kit
E-EL-H2414-03 96 Tests

Human αMSH (Alpha-Melanocyte Stimulating Hormone) ELISA Kit

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-100 1x 100 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details