Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKBIZ Peptide - C-terminal region

NFKBIZ Peptide - C-terminal region

Product Specifications

Product Name Alternative

INAP, Mail, AA408868

UniProt

Q9EST8

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001152866.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,6-Dichloro-alpha-(4-chlorophenyl)-4-nitrobenzeneacetonitrile
TRC-D434135-50G 50 g

2,6-Dichloro-alpha-(4-chlorophenyl)-4-nitrobenzeneacetonitrile

Sign In for Pricing
View Details
Vinyl Acetate (Stabilized with 8-12 ppm Hydroquinone)
TRC-V368700-25ML 25 mL

Vinyl Acetate (Stabilized with 8-12 ppm Hydroquinone)

Sign In for Pricing
View Details
6-N-Biotinylaminohexyl Isopropyl Phosphorofluoridate, Hemihydrate
TRC-B394900-50MG 50 mg

6-N-Biotinylaminohexyl Isopropyl Phosphorofluoridate, Hemihydrate

Sign In for Pricing
View Details
PANK2 (N-term) Rabbit Polyclonal Antibody
AP13804PU-N 400 µL

PANK2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD1b (RIV12), CF405S conjugate, 0.1mg/mL
BNC040317-500 1x 500 µL

CD1b (RIV12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CytoCalcein™ Violet 450 *Excited at 405 nm*
22012-AAT 1 mg

CytoCalcein™ Violet 450 *Excited at 405 nm*

Sign In for Pricing
View Details