Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNB2L1 Peptide - middle region

GNB2L1 Peptide - middle region

Product Specifications

Product Name Alternative

P205, Gnb2l1, GB-like, AL033335, Gnb2-rs1

UniProt

P68040

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032169.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Pancreas
CB521570 1 Block

Frozen Tissue Blocks, Pancreas

Sign In for Pricing
View Details
6-Hydroxy-2-naphthalenesulfonic Acid Sodium Salt
TRC-H950735-5G 5 g

6-Hydroxy-2-naphthalenesulfonic Acid Sodium Salt

Sign In for Pricing
View Details
GPR37 (N-term extracell. dom.) Rabbit Polyclonal Antibody
AP06819PU-N 50 µg

GPR37 (N-term extracell. dom.) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adamdec1 Mouse Gene Knockout Kit (CRISPR)
KN500847 1 Kit

Adamdec1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tmem125 Mouse Gene Knockout Kit (CRISPR)
KN517709 1 Kit

Tmem125 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ac-lys(ac)-OH
TRC-A169240-500MG 500 mg

Ac-lys(ac)-OH

Sign In for Pricing
View Details