Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNB2L1 Peptide - middle region

GNB2L1 Peptide - middle region

Product Specifications

Product Name Alternative

P205, Gnb2l1, GB-like, AL033335, Gnb2-rs1

UniProt

P68040

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032169.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC mu (PRKD1) Rabbit Polyclonal Antibody
AP02657PU-N 100 µL

PKC mu (PRKD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
S100 alpha 2 (S100A2) (NM_005978) Human Over-expression Lysate
LY401808 100 µg

S100 alpha 2 (S100A2) (NM_005978) Human Over-expression Lysate

Sign In for Pricing
View Details
Rnasek (NM_173742) Mouse Tagged ORF Clone
MG200295 10 µg

Rnasek (NM_173742) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
UQCC (UQCC1) (NM_001184977) Human Over-expression Lysate
LC432731 20 µg

UQCC (UQCC1) (NM_001184977) Human Over-expression Lysate

Sign In for Pricing
View Details
Tyrosinase (TYR) Rabbit Polyclonal Antibody
AP06471PU-N 100 µg

Tyrosinase (TYR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
hSET1 (SETD1A) Human Gene Knockout Kit (CRISPR)
KN414996 1 Kit

hSET1 (SETD1A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details