Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRR7 Peptide - middle region

PRR7 Peptide - middle region

Product Specifications

Product Name Alternative

XM_484263

UniProt

Q3V0I2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001025467.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO1 Rabbit Monoclonal Antibody [Clone ID: R07-7C4]
TA384252 100 µL

FOXO1 Rabbit Monoclonal Antibody [Clone ID: R07-7C4]

Sign In for Pricing
View Details
SAP155 (SF3B1) Human Gene Knockout Kit (CRISPR)
KN219649 1 Kit

SAP155 (SF3B1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rac-erythro-meta-nitro-Chloramphenicol
TRC-C325010-10MG 10 mg

rac-erythro-meta-nitro-Chloramphenicol

Sign In for Pricing
View Details
Col17a1 Mouse Gene Knockout Kit (CRISPR)
KN503621 1 Kit

Col17a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Red Fluorescent SR-FLICA® Caspase-8 (LETD) Assay Kit
9150 100 Tests

Red Fluorescent SR-FLICA® Caspase-8 (LETD) Assay Kit

Sign In for Pricing
View Details
ANKRD34C Human Gene Knockout Kit (CRISPR)
KN428434 1 Kit

ANKRD34C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details