Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRR7 Peptide - middle region

PRR7 Peptide - middle region

Product Specifications

Product Name Alternative

XM_484263

UniProt

Q3V0I2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001025467.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

trans 4-Hydroxy-L-proline beta-Naphthylamide
TRC-H952390-500MG 500 mg

trans 4-Hydroxy-L-proline beta-Naphthylamide

Sign In for Pricing
View Details
PPAP2C (PLPP2) Human Gene Knockout Kit (CRISPR)
KN401192 1 Kit

PPAP2C (PLPP2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Arg8-Vasopressin (AVP) ELISA Kit
K049-H1 1 Plate

Arg8-Vasopressin (AVP) ELISA Kit

Sign In for Pricing
View Details
Human IgG F(ab')2 Antibody Biotin Conjugated
TA397760 2 mg

Human IgG F(ab')2 Antibody Biotin Conjugated

Sign In for Pricing
View Details
1-(2-Ethoxyphenyl)piperazine Monohydrochloride 99
TRC-E941100-5G 5 g

1-(2-Ethoxyphenyl)piperazine Monohydrochloride 99

Sign In for Pricing
View Details
(2S)-2-Amino-3-(4-nitrophenyl)-1-propanol-d6
TRC-A618367-2.5MG 2.5 mg

(2S)-2-Amino-3-(4-nitrophenyl)-1-propanol-d6

Sign In for Pricing
View Details