Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFV1 Peptide - middle region

NDUFV1 Peptide - middle region

Product Specifications

Product Name Alternative

CI-51kD

UniProt

Q91YT0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_598427.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Texas Red® goat anti-mouse IgG (H+L) *Cross Adsorbed*
16861-AAT 1 mg

Texas Red® goat anti-mouse IgG (H+L) *Cross Adsorbed*

Sign In for Pricing
View Details
delta-Valerolactam
TRC-V091440-50G 50 g

delta-Valerolactam

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF647 conjugate, 0.1mg/mL
BNC471118-100 1x 100 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NHLRC3 (NM_001017370) Human Over-expression Lysate
LC422644 20 µg

NHLRC3 (NM_001017370) Human Over-expression Lysate

Sign In for Pricing
View Details
HIPPI (IFT57) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H2]
TA500907BM 100 µL

HIPPI (IFT57) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H2]

Sign In for Pricing
View Details
Human GRIFIN activation kit by CRISPRa
GA118364 1 Kit

Human GRIFIN activation kit by CRISPRa

Sign In for Pricing
View Details